Protein Info for CCNA_02776 in Caulobacter crescentus NA1000 Δfur

Annotation: cobyric acid synthase CobQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF13500: AAA_26" amino acids 3 to 227 (225 residues), 49.5 bits, see alignment E=7.1e-17 PF01656: CbiA" amino acids 4 to 236 (233 residues), 64.4 bits, see alignment E=1.5e-21 TIGR00313: cobyric acid synthase CobQ" amino acids 4 to 444 (441 residues), 428 bits, see alignment E=2.5e-132 PF07685: GATase_3" amino acids 252 to 433 (182 residues), 194.6 bits, see alignment E=2.1e-61

Best Hits

Swiss-Prot: 74% identical to COBQ_CAUSK: Cobyric acid synthase (cobQ) from Caulobacter sp. (strain K31)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 100% identity to ccs:CCNA_02776)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.10

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBF6 at UniProt or InterPro

Protein Sequence (484 amino acids)

>CCNA_02776 cobyric acid synthase CobQ (Caulobacter crescentus NA1000 Δfur)
MAALMIQGCGSDVGKSVLVAGLCRLFANRGFAVRPFKPQNMSNNAAVTAEGGEIGRAQAL
QAIACRTPPTVEMNPVLLKPQSDIGAQVVVRGRMAGSWAASGYQDHKASLLPIVVESFRA
LERQSDLVIVEGAGSPAEINLRAGDIANMGFARAADVPVVLVGDIDRGHVIAALVGAHAV
LDPEDRAMIKGFLINKFRGDPALFDDGRRAIVERTGWADLGMAPWLAAARRLPAEDAVVL
DARSAGRDGRIRIVVPMLSRIANFDEFDALRAEPGVAFAFVPPGSALPGDADVVILPGTK
ATRADLDFVRAQGWDIDLQAHLRRSGRVLGICGGYQMLGRRVADPDGVEGAPGTSEGLGL
LDVETVMTGDKTLRPVTGRLPGGARFEGYEMHVGRTSGAARPMLTFDTGETDGAVSADGR
VSGCYVHGLFDRGEARAALLAELGVASDAADQAVRVDLALDEIAAALESAFDIRSLARLA
GLRV