Protein Info for CCNA_02729 in Caulobacter crescentus NA1000 Δfur

Annotation: oligopeptide transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 202 to 207 (6 residues), see Phobius details amino acids 212 to 212 (1 residues), see Phobius details amino acids 219 to 246 (28 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 317 to 341 (25 residues), see Phobius details amino acids 353 to 379 (27 residues), see Phobius details amino acids 386 to 409 (24 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details amino acids 456 to 477 (22 residues), see Phobius details amino acids 519 to 539 (21 residues), see Phobius details amino acids 554 to 577 (24 residues), see Phobius details amino acids 594 to 618 (25 residues), see Phobius details amino acids 637 to 656 (20 residues), see Phobius details TIGR00728: oligopeptide transporter, OPT superfamily" amino acids 12 to 617 (606 residues), 316.7 bits, see alignment E=3.7e-98 PF03169: OPT" amino acids 12 to 616 (605 residues), 331.3 bits, see alignment E=7.1e-103 TIGR00733: oligopeptide transporter, OPT family" amino acids 12 to 618 (607 residues), 625.8 bits, see alignment E=7.2e-192

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02729)

Predicted SEED Role

"oligopeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CBB6 at UniProt or InterPro

Protein Sequence (666 amino acids)

>CCNA_02729 oligopeptide transporter (Caulobacter crescentus NA1000 Δfur)
MLMADTTAPRTELTLRGVLLGILITLVFTAAQVYLGLKVGLTFATAIPAAVISMALLRAF
KTSTIQENNIVQTIASAAGTLSAVIFVLPGLLMIGWWANVPFLPTFGACAVGGILGVMYT
IPLRRALVTNSNLPYPEGVAAAEVLKVGAGSREGAAEGKAGLAAIGFSALASALFGALGA
AKLFAAEIAAYFKFKLGAASGATGIGASSSLALMGAGHLMGITVGVAMFTGLFIAWAILV
PILTLVTPMPEADAATHALTVWKSQVRFLGAGVIGAAAIWTLAKLVGPITSGLKSAFAAA
QARKAGGAKLPRVEQDIPIGIVGLVSVLLLAPAGWFLAHFLTGGPIASLTTPLVAIGIGY
LVFAGLLAAAVCGYMAGLIGSSNSPVSGIAILSVLGASLMVGMVGRGVIGPDVTKALIAF
ALYVTTCVLAVAVVANDNLQDLKTGQLVDATPWKQQVGLIIGVLAGSMVIPFVLELLNRS
YGFAGAPNLQAISDEPLAAPQATLISTLAKGVLGGNLDWGLLGYGALIGLGLVAVDAILR
KTSHERLSLPPLGVGLAIYLPSSVTAPVVVGALAGWLYEKVVSKDRAAEPSRRLGVLIAS
GFIVGESLFNVSLALLIVSTGKGDPLALPFAPSEHVGMFLSLAAAAIVVVGFYRWARKAG
AKAMEA