Protein Info for CCNA_02638 in Caulobacter crescentus NA1000 Δfur

Annotation: CLC voltage-gated chloride channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 57 to 81 (25 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 273 to 295 (23 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 372 to 392 (21 residues), see Phobius details amino acids 404 to 430 (27 residues), see Phobius details amino acids 436 to 457 (22 residues), see Phobius details PF00654: Voltage_CLC" amino acids 127 to 454 (328 residues), 213.2 bits, see alignment E=5.9e-67 PF00571: CBS" amino acids 557 to 602 (46 residues), 20.5 bits, see alignment 4.9e-08

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to ccs:CCNA_02638)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CCM1 at UniProt or InterPro

Protein Sequence (618 amino acids)

>CCNA_02638 CLC voltage-gated chloride channel (Caulobacter crescentus NA1000 Δfur)
MTEPAEAPEPESAKAASPPWRSVLRVAAIDRARLREAGRQALPWLAWLRRRTRSSELWVI
AVATVVGLVAGALAVALGALAHGTQVAIFNFDPNERLSAQVMIEPWRLLAIPLGGLVLGL
FTAAVLRFRPNHAVDPVEANALHGGRLSIRDSLIICVQTLISNGSGASVGLEAAYAQAGG
ATASWVGQRLNLRRGDLRILVGAGAGAAIAAAFGAPLTGAFYAFEIVIGAYTVANIAPVA
AAALAGVLVAKALGSTPYLLKTSVVAISSPADYALYGLLGLLAAFFGVALMRAVAVADGW
AIKAPLPRWSKPAIGGVALAALALATPQTLSGGHGALHLDLNSDLPLKVLLVLILMKAVA
SIVSLSSGFRGGLFFAALFLGVLMGQAFALVVNMTTGTVHLDPIAASLVGMGALGVAIVG
GPFTMSFLVLEVTGDFTVTGATLAASLIASAVVRETFGYSFSTWRLHLRGETIRSAHDVS
WMRNLTAGKMMRRDVKTIAAGTSLAEFRRRFPLGSTKRAVLTDETGRYAGIVATAAVYAE
PPERDATVAALAAHTRVALAPELSIKAIMTAFDETGADELAVVDEGGEVIGLITEAHVTR
RYAEELEKARRELTGDTG