Protein Info for CCNA_02628 in Caulobacter crescentus NA1000 Δfur

Annotation: UDP-N-acetylenolpyruvoylglucosamine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 20 to 298 (279 residues), 190.9 bits, see alignment E=1.5e-60 PF01565: FAD_binding_4" amino acids 33 to 162 (130 residues), 73.3 bits, see alignment E=1.7e-24 PF02873: MurB_C" amino acids 199 to 297 (99 residues), 106 bits, see alignment E=1e-34

Best Hits

Swiss-Prot: 100% identical to MURB_CAUVC: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to ccs:CCNA_02628)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H085 at UniProt or InterPro

Protein Sequence (301 amino acids)

>CCNA_02628 UDP-N-acetylenolpyruvoylglucosamine reductase (Caulobacter crescentus NA1000 Δfur)
MTWKTQLPTARGKLLIDEALAPFTWFRVGGPADVVFLPADEQDLSDFLKGLDPSVPVMAI
GVGSNLLVRDGGVDGVVIRLGKGFNGVEALGDNRIKAGSAVPDAILARKAAEAGIAGLEF
YVGVPGTIGGAVIMNAGCYGAETVNVVKSVRVMNRAGVVRELSVEDLHYTYRHSALQDGE
PVIVLDAIFEGTPDEPEAIKARMAEITARRETTQPIREKTGGSTFKNPPGHSSWKLVDEA
GWRGKPYGGAMFSPLHSNFLINTGEATAADLEGLGEAVRADVLAKTGVQLDWEIKRIGRA
G