Protein Info for CCNA_02609 in Caulobacter crescentus NA1000 Δfur

Annotation: membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 258 to 273 (16 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details PF03547: Mem_trans" amino acids 159 to 302 (144 residues), 55.4 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to ccr:CC_2524)

Predicted SEED Role

"FIG00483168: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAZ7 at UniProt or InterPro

Protein Sequence (312 amino acids)

>CCNA_02609 membrane transport protein (Caulobacter crescentus NA1000 Δfur)
MLVLDVAARVWPFFLLVAAGVALSRLRLLDARMTQGLSAYVYWVGFPALLIHSLSRLGRP
GPELWSGLAAYAAVGLAVMASLVVGGRALGWSRPERAGAAMAAGVGNSAFLAVPVTAAVL
GAETARLVAGAIAADFVVLAAAGVGLLGWAAGRSVWRAMAQAFQNPVVIAALLGLLLALL
NLALPQPLDRAVGLAAASGSPVGLVALGAALGLPQTEDEPGPRAGPVVLAALAKLLAFPL
LVWLAIGLTPAPAEFRTGATLVAAAPTAVNVFIQTRAYGVWPRGAARIVALTTALAIVSL
SLVAILLTARVS