Protein Info for CCNA_02571 in Caulobacter crescentus NA1000 Δfur

Annotation: major facilitator superfamily transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 18 to 36 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 281 to 306 (26 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 367 (24 residues), see Phobius details amino acids 379 to 403 (25 residues), see Phobius details amino acids 467 to 489 (23 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 395 (369 residues), 178.8 bits, see alignment E=2.2e-56 PF00083: Sugar_tr" amino acids 79 to 408 (330 residues), 42.1 bits, see alignment E=8.5e-15 PF03137: OATP" amino acids 118 to 334 (217 residues), 43.6 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02571)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAZ8 at UniProt or InterPro

Protein Sequence (497 amino acids)

>CCNA_02571 major facilitator superfamily transporter (Caulobacter crescentus NA1000 Δfur)
MAEAHASGGDRPLYSNGYKATVLGLLLATYTFNFIDRTIISTIGQAIKVDLKLTDTQLGL
LGGLYFALLYTILGIPIARLAERFNRVTIISVSLVIWSGFTALCGAAANFAQLALFRFGV
GVGEAGCSPPSHSLISDYYEPKKRATALSIYSFGIPLGTMFGAVAGGWLAQEFSWRVAFV
IVGLPGILLAVIVKLVVKEPPRGHSEIVERPLEAEDVVVEPAKPAFSMANEFKELWAVTK
ILFGKWPVLHMVLGVTIASFGAYGSGAFVPSYFVRAFDLGLAQVGLITGLIGGFSAGVGT
LVGGFLSDWAGKRSAKWYALTPAIGLILCTPIYILAYLQTDWQTTALILLVPGIFHYVYL
APTFGVVQNSVEPRRRATATALLFFFLNIIALGVGPVFTGWLIDHLAQFHFNNPGGGVIA
SVLGSFGGEAGQSFASACPGGIAPKGASAELVAQCKTTLSVASQQGIIVSLCFYAWAGLH
YALAAIGMVKHFEARKA