Protein Info for CCNA_02568 in Caulobacter crescentus NA1000 Δfur

Annotation: LAO/AO transport system kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR00750: LAO/AO transport system ATPase" amino acids 17 to 320 (304 residues), 349.7 bits, see alignment E=6.1e-109 PF03308: MeaB" amino acids 22 to 293 (272 residues), 427.9 bits, see alignment E=1.3e-132 PF02492: cobW" amino acids 57 to 210 (154 residues), 27 bits, see alignment E=3.3e-10

Best Hits

Swiss-Prot: 100% identical to Y2483_CAUVC: Putative GTPase CC_2483 (CC_2483) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K07588, LAO/AO transport system kinase [EC: 2.7.-.-] (inferred from 100% identity to ccs:CCNA_02568)

Predicted SEED Role

"putative periplasmic protein kinase ArgK and related GTPases of G3E family"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9F3 at UniProt or InterPro

Protein Sequence (326 amino acids)

>CCNA_02568 LAO/AO transport system kinase (Caulobacter crescentus NA1000 Δfur)
MIPALDIDSLEHRLVAGDRAALARAITLVESRRADHQVAARTLLSRLMPLTGRAQRIGIT
GVPGAGKSTTIERFGCNLVEAGHRVAVLAVDPSSGRHGGSILGDKTRMEQLSVQANAFIR
PSPSGGALGGVARKTREAMLLCEAAGFDVVIIETVGVGQSETVVADMVDIFLALLIPGGG
DELQGIKKGLIELADLLVINKADADPAKAERSARDYRNALHILTPAHPDWTPPVLTASGL
TGQGLDVLWTQILRHREVMTANGARAARRADQDARWMWAMVRDRLEDAFKTAPAVAALVP
DLETAVREGEVPASAAADRLLAAFGL