Protein Info for CCNA_02529 in Caulobacter crescentus NA1000 Δfur

Annotation: DNA recombination-mediator protein A, SMF family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF21102: DprA_N" amino acids 10 to 72 (63 residues), 76.2 bits, see alignment E=1.9e-25 TIGR00732: DNA protecting protein DprA" amino acids 74 to 285 (212 residues), 228.2 bits, see alignment E=3.5e-72 PF02481: DNA_processg_A" amino acids 74 to 275 (202 residues), 232.7 bits, see alignment E=4e-73 PF17782: DprA_WH" amino acids 308 to 360 (53 residues), 39.3 bits, see alignment 8.3e-14

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to ccs:CCNA_02529)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9B5 at UniProt or InterPro

Protein Sequence (365 amino acids)

>CCNA_02529 DNA recombination-mediator protein A, SMF family (Caulobacter crescentus NA1000 Δfur)
MTPGRLSDIQRFAWLRLARTETVGPVAFDHLLTRYGTPERALSALPDLSRKGGRAVPLSL
PPREAIEQELEAGEKLGARLICGGEPDFPPRLAALDPPPPVLWALGRAELLSQPSLAIVG
ARIASAAGQRFARQLATDLGTAGHVIVSGMARGIDGAAHEGSLATGAVAVLGGGVGDIYP
PEHDKLHARLAAEGCVVSESAPDRRAQAKDFPRRNRIISGLSLGVIVVEAELKSGSLITA
RLAAEQGRDVFAVPGSPLDPRSKGTNDLIRQGAILCEGAEDVLRSLSGQTHLREQDRAYE
ALPDMDIDHDALRERVAALLSPTPVSRNDLVRAAAAPASAVMAALVELSLARRAELLDGG
MVAGV