Protein Info for CCNA_02528 in Caulobacter crescentus NA1000 Δfur

Annotation: PlsY-like acyl-phosphate glycerol 3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 170 to 186 (17 residues), see Phobius details TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase" amino acids 14 to 204 (191 residues), 179.1 bits, see alignment E=4.4e-57 PF02660: G3P_acyltransf" amino acids 19 to 194 (176 residues), 178.8 bits, see alignment E=4.6e-57

Best Hits

Swiss-Prot: 100% identical to PLSY_CAUVC: Glycerol-3-phosphate acyltransferase (plsY) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to ccr:CC_2446)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZK4 at UniProt or InterPro

Protein Sequence (218 amino acids)

>CCNA_02528 PlsY-like acyl-phosphate glycerol 3-phosphate acyltransferase (Caulobacter crescentus NA1000 Δfur)
MQDLAAIAYLTLGIAIVGGYLLGSIPFGLIATRLGGAGDIRQIGSGNIGATNVLRSGRKD
LAAITLLGDAGKGVVAVLLARYLTNGNPAIIALAGGSAFLGHLFPVWLKFKGGKGVATFY
GVLLSAAWPVGVAAGATWLAMAFLFRISSLAALTAAVLAAPFALAFDQPYPFMGLCLFMA
VLIFIRHRENIARLLKGEEPKIGKKKPAEEAPPAPDAP