Protein Info for CCNA_02491 in Caulobacter crescentus NA1000 Δfur

Annotation: protocatechuate 3,4-dioxygenase beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12391: PCDO_beta_N
  • amino acids 5 to 38 (34 residues), 43.6 bits, 1.8e-15
• TIGR02422: protocatechuate 3,4-dioxygenase, beta subunit
  • amino acids 12 to 231 (220 residues), 325.6 bits, E=8.1e-102
• PF00775: Dioxygenase_C
  • amino acids 59 to 223 (165 residues), 175.5 bits, E=7.7e-56

Best Hits

KEGG orthology group: K00449, protocatechuate 3,4-dioxygenase, beta subunit [EC: 1.13.11.3] (inferred from 100% identity to ccs:CCNA_02491)

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
• aromatic compounds degradation via β-ketoadipate (6/9 steps found)
• 4-sulfocatechol degradation (1/4 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (12/35 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

See A0A0H3CAM8 at UniProt or InterPro

Protein Sequence (235 amino acids)

>CCNA_02491 protocatechuate 3,4-dioxygenase beta chain (Caulobacter crescentus NA1000 Δfur)
MNPNFKREDAGQPPSLHAPYASTVPRSPRQPLVRIPHTLTETTGPSNAWPRLMGGAMADL
TTQHKAMPQGQRIIVSGRVLDEDGRPVPNTVMEIWQANAAGRYIHKKDQWDAPLDPNFTG
AGRVITDDEGRYQFVSIRPGAYPWGNHHNAWRPAHIHLSLLGPAFATRLVTQMYFPDDPL
IEIDPIANAVPLPYRQRLVSRFDIEATKPNWALGYLFDVVLRGRDQTPFEDDHHA