Protein Info for CCNA_02476 in Caulobacter crescentus NA1000 Δfur

Annotation: vanillate demethylase oxygenase subunit A vanA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF00355: Rieske" amino acids 16 to 100 (85 residues), 66.1 bits, see alignment E=2.2e-22 PF19112: VanA_C" amino acids 150 to 349 (200 residues), 170.7 bits, see alignment E=4.3e-54

Best Hits

Swiss-Prot: 71% identical to VANA_PSEUH: Vanillate O-demethylase oxygenase subunit (vanA) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: K03862, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 100% identity to ccs:CCNA_02476)

MetaCyc: 71% identical to vanillate O-demethylase oxygenase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Vanillate O-demethylase oxygenase subunit (EC 1.14.13.82)" in subsystem Phenylpropanoid compound degradation (EC 1.14.13.82)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.82

Use Curated BLAST to search for 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAL1 at UniProt or InterPro

Protein Sequence (358 amino acids)

>CCNA_02476 vanillate demethylase oxygenase subunit A vanA (Caulobacter crescentus NA1000 Δfur)
MGTETVAKAAPWPLDAWYVACTPDEIADRPLGRRICGKAMVFHRGKDDRPVALEDFCPHR
GAPLSLGFVRDGELVCGYHGLTMGCEGRATAMPGQRVAAFPAIRAFPVLERYGFIWVWPG
DPAQADPAKLHPLFWADSPDWAYGGGLYHIACDYRLMVDNLMDLTHETYVHATSIGQKEI
DEAPVTTRLEGEEVVTSRFMEGIHAPPFWRMALRGAGLPENALVDRWQICRFSLPSHVMI
EVGVALAGHGGYHAPADKKVSSVVVDFITPETETSHHYFWGMARSFAVGDAALTDTIREG
QGKIFSEDLEMLERQQKNLLAYPDRKLLKLNIDAGGVRSRMAIDKAIAAETALAAQAK