Protein Info for CCNA_02462 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details PF01906: YbjQ_1" amino acids 1 to 104 (104 residues), 115.6 bits, see alignment E=7.8e-38

Best Hits

Swiss-Prot: 100% identical to Y2462_CAUVN: UPF0145 protein CCNA_02462 (CCNA_02462) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02462)

Predicted SEED Role

"UPF0145 protein BT_3410"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GZD8 at UniProt or InterPro

Protein Sequence (105 amino acids)

>CCNA_02462 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MLITTTPFIEGRPVQEYKGAIYAQSILGANVVLDLLAAIRDFIGGHSKSYERVLARARED
AMKNLIKEAEKLGANAILAVDLDYNTVGPQGSMMMVSVSGTAVVL