Protein Info for CCNA_02403 in Caulobacter crescentus NA1000 Δfur

Annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 119 to 143 (25 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 260 to 288 (29 residues), see Phobius details amino acids 308 to 326 (19 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 154 to 367 (214 residues), 212.9 bits, see alignment E=3.2e-67 PF02405: MlaE" amino acids 155 to 364 (210 residues), 227.7 bits, see alignment E=6.2e-72

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to ccr:CC_2318)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CC01 at UniProt or InterPro

Protein Sequence (371 amino acids)

>CCNA_02403 ABC transporter permease protein (Caulobacter crescentus NA1000 Δfur)
MALPADFTLTEQDGGLVAVLAGDWTARGLFDAGPRLTEALEDRRDLRFDLTGVNRCDTAG
AYAILRAAGDRLKSDRIIARKQVLRLLELVGAAIKVEPQRAARPTGFYALLERIGRGVFG
LFADGYGTLVFLGHLLVALGRSIVSPHRIRWAPIVALCERAGLDAMPIIATTTFFIGAVV
ALLGANMLTDFGAQVYAVELIGISVMREFNILITAILLAGRSASSFAAEIGSMKMNQEID
AMQVMGVDPYEALVLPRFAALLLTIPLLTFVATIAGLAGGILVVWSVLDLSPTFFLQRIV
DYVGATHFWIGLSKAPVMAMVIAAIGCRQGMEVGKDIESLGRRVTAAVVHAIFAIILIDA
VFALIYMELDI