Protein Info for CCNA_02390 in Caulobacter crescentus NA1000 Δfur

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00702: Hydrolase" amino acids 11 to 189 (179 residues), 114.3 bits, see alignment E=1.9e-36 PF13419: HAD_2" amino acids 12 to 193 (182 residues), 100.1 bits, see alignment E=3.4e-32 PF12710: HAD" amino acids 12 to 182 (171 residues), 47 bits, see alignment E=8.4e-16 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 12 to 221 (210 residues), 166 bits, see alignment E=1.3e-52 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 89 to 189 (101 residues), 33.4 bits, see alignment E=8.6e-12 PF13242: Hydrolase_like" amino acids 151 to 218 (68 residues), 38 bits, see alignment E=2.6e-13

Best Hits

Swiss-Prot: 100% identical to GPH_CAUVC: Phosphoglycolate phosphatase (gph) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to ccs:CCNA_02390)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAC0 at UniProt or InterPro

Protein Sequence (237 amino acids)

>CCNA_02390 phosphoglycolate phosphatase (Caulobacter crescentus NA1000 Δfur)
MSTLHDLNGATIAFDLDGTLVDTAPDLVGALNIILAQESLPPLPFDDVRLMVGRGARALL
ERGFAAAGAPLDAEQAPALVQRFIDVYLARIADESAPFPGVVEVLSDLKTAGAKLVVCTN
KLTNLSTALLDAVALSPFFEAVIGADLAPAAKPDGRHVAAAVAAVGGDVSRAVMIGDSVN
DALGARNAGVPGVLVSFGYTEEPVETLGADLVIHSFLDVPKACITLLTSCPAPNTGL