Protein Info for CCNA_02329 in Caulobacter crescentus NA1000 Δfur

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 PF13742: tRNA_anti_2" amino acids 14 to 107 (94 residues), 82.9 bits, see alignment E=2.4e-27 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 15 to 355 (341 residues), 385.2 bits, see alignment E=2e-119 PF01336: tRNA_anti-codon" amino acids 34 to 107 (74 residues), 39.2 bits, see alignment E=7.9e-14 PF02601: Exonuc_VII_L" amino acids 130 to 470 (341 residues), 326.6 bits, see alignment E=3.1e-101

Best Hits

Swiss-Prot: 100% identical to EX7L_CAUVC: Exodeoxyribonuclease 7 large subunit (xseA) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to ccr:CC_2246)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GYM1 at UniProt or InterPro

Protein Sequence (505 amino acids)

>CCNA_02329 exodeoxyribonuclease VII large subunit (Caulobacter crescentus NA1000 Δfur)
MSDLPPTDSNAPPYSVSELAFALKRTLEDRYGFVRLRGELSKVTHHSNGHVYLTIKDDKS
AIDGVVWKGNVRGLGVRPEHGLEVIVTGKITTYPAGSRYQIVIDSMEAAGVGALLAQLER
LKAKLAAEGLFAPERKRPLPSMPAVVGVITSPTGAVIRDILHRIRDRWPCQVLVWPCVVQ
GDAAAGQVSAAIRGFNAIQPGGPVPRPDVLIVARGGGSVEDLWAFNDEGLARTVAEGTIP
LISAVGHETDTTLIDFVSDRRAPTPTAAAEMATPVLAELRALISDLDRRLNRCGARTIEE
RRTRLVSAARGLPRPNDLLALAQQRFDIASGRLDAALDRNTTVHAQSLLKVTARLTPEAL
GRQRAVKAERLADLSRRLDLAARRAPDRVAQHARLPALWDRLNAAGQRRLQRDADRLENL
EKLRQSLNPERPLELGFALVRKGDGTLARSAADLVSGERVNLKFKSGDRDAVIDGEGGPA
PAPTAPAPKPRPKPAAPPAGQGDLF