Protein Info for CCNA_02307 in Caulobacter crescentus NA1000 Δfur

Annotation: cyclohexadienyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF01262: AlaDh_PNT_C" amino acids 4 to 115 (112 residues), 27.2 bits, see alignment E=6.1e-10 PF03807: F420_oxidored" amino acids 10 to 90 (81 residues), 31.6 bits, see alignment E=5.4e-11 PF03446: NAD_binding_2" amino acids 11 to 133 (123 residues), 24.6 bits, see alignment E=5.7e-09 PF02153: PDH_N" amino acids 25 to 180 (156 residues), 114.7 bits, see alignment E=7.1e-37 PF20463: PDH_C" amino acids 185 to 283 (99 residues), 104.6 bits, see alignment E=8.2e-34

Best Hits

KEGG orthology group: K00220, cyclohexadieny/prephenate dehydrogenase [EC: 1.3.1.12 1.3.1.43] (inferred from 100% identity to ccr:CC_2224)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA35 at UniProt or InterPro

Protein Sequence (312 amino acids)

>CCNA_02307 cyclohexadienyl dehydrogenase (Caulobacter crescentus NA1000 Δfur)
MPNPGVLYPKLTVIGCGLIGGSVIRAARQHGVVGEITVADASEAHRARVTELGIAEHVTG
DIAEAVKDADLVVIATPVLSVPELARVVIPAMKPGATLTDVGSTKGNVAEAFRAQDLSKI
FAIPGHPIAGTEQSGPDAGFAELFENRWTILTPFESEDDHYAAAVAKLSAFWRAFGAQVE
LMDDKHHDLVLAVVSHLPHLIAYTIVGSAADLENVTENEVIKYSASGFRDFTRIAASDPT
MWRDIFVANKDAVLEMLGRFTEDLQAMSRAIRWGDADTLHAHFTRTRAIRRGIVAAGQES
AEPNFGRDRGKH