Protein Info for CCNA_02290 in Caulobacter crescentus NA1000 Δfur

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02290)

Predicted SEED Role

"FIG00481532: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8P7 at UniProt or InterPro

Protein Sequence (215 amino acids)

>CCNA_02290 hypothetical protein (Caulobacter crescentus NA1000 Δfur)
MRGADMSKDLKSVQDDLAFLRGLAEGSQERGGLGVAGGALYGAAGLLYGLQSLIYVVQER
GLIGLGGLGNLILAWAPTVIFLVLMIIVIIKDHKNPQRGVTNRAVNAAFQATGVANLALI
IVFAAAASRHKDFHYWLFHPAVVFILQGAVWQVIYVLRRRMWMLVVALGWLVSGVAMGLL
IERADLYLLIASFGLFAFMAAPGFYMMRQAMRSAA