Protein Info for CCNA_02231 in Caulobacter crescentus NA1000 Δfur

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 TIGR03719: ATP-binding cassette protein, ChvD family" amino acids 3 to 552 (550 residues), 938 bits, see alignment E=1.8e-286 PF00005: ABC_tran" amino acids 24 to 189 (166 residues), 85.4 bits, see alignment E=2e-27 amino acids 340 to 473 (134 residues), 92.2 bits, see alignment E=1.6e-29 PF12848: ABC_tran_Xtn" amino acids 228 to 301 (74 residues), 43 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 59% identical to ETTA_MYCTO: Energy-dependent translational throttle protein EttA (ettA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_02231)

Predicted SEED Role

"ABC transporter, ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA59 at UniProt or InterPro

Protein Sequence (555 amino acids)

>CCNA_02231 ABC transporter ATP-binding protein (Caulobacter crescentus NA1000 Δfur)
MAQQYIFQMQGLTKAYPGGKKVFENIWLSFYSDAKIGVVGVNGSGKSTLLKVMAGLDKEF
SGEAKAADGIKRGYLPQEPVLDPTLDVWGNVIADCEDKQIFDRYNALAAQLGEEYTDELM
EEMTKLQEVIDARDLWDIDSKVEMAIDALRCPPNDANIESLSGGEKRRIALARLLLSKPD
MLLLDEPTNHLDAESVAWLQHHLEEFPGCVILVTHDRYFLDQVTKWTLELDRGKGVPYEG
NYSGWLEQKQKRVVQEQSESEARQRALTRELEWVRSSPKARQSKSKARLASYEEMVAAQE
NARAAQTQAHIQIPPGPRLGNLVLEVNGLEKEYGDKVLFKDLSFRLPPNGIVGVIGPNGA
GKSTLFKLITGREQPDAGTVKVGETVKLSYVDQSRDALDPNKTIWEEISGGTDVMIVGKR
EINSRAYVGSFNFKGGDQQKKVGLLSGGERNRVHLAKTLATGGNLLLLDEPTNDLDIETL
QALEEALEEFAGCAVVISHDRWFLDRLATHILAFEGDSHVEWFEGNFEMYEEDKKRRLGA
DSLIPKRIKFQKFAR