Protein Info for CCNA_02142 in Caulobacter crescentus NA1000 Δfur

Annotation: flagellar basal-body rod protein flgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR03506: flagellar hook-basal body protein" amino acids 3 to 124 (122 residues), 137 bits, see alignment E=1.3e-43 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 47.2 bits, see alignment 2.5e-16 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 5 to 221 (217 residues), 208 bits, see alignment E=1.4e-65 PF22692: LlgE_F_G_D1" amino acids 85 to 150 (66 residues), 60.1 bits, see alignment E=2.8e-20 PF06429: Flg_bbr_C" amino acids 196 to 238 (43 residues), 56.1 bits, see alignment 3.2e-19

Best Hits

Swiss-Prot: 100% identical to FLGF_CAUVC: Flagellar basal-body rod protein FlgF (flgF) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 100% identity to ccs:CCNA_02142)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8B6 at UniProt or InterPro

Protein Sequence (245 amino acids)

>CCNA_02142 flagellar basal-body rod protein flgF (Caulobacter crescentus NA1000 Δfur)
MDNALYVGLSRQMTLRRELDIVANNIANANTTGFKVEDLMVRTEQAKPAKTLDGSSPVKF
VMDTGVARNFTQGPMTKTGGDYDLAINGMGFFKVQANGGERYTRDGRFTTNPEGILVTQA
GAPVLDDGGGQITIDPRLGPVTVGKDGIVSQGAIRVGRIGLVRPDDLSTFAKDGDNLYRN
TTNTAPQPVTDAQIHQGMLEASNVQPVIEITKLIEIQRAYESVAKMMDNTAELSRSAVER
LGKIN