Protein Info for CCNA_02129 in Caulobacter crescentus NA1000 Δfur

Annotation: acyl-CoA dehydrogenase, short-chain specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF02771: Acyl-CoA_dh_N" amino acids 5 to 119 (115 residues), 81 bits, see alignment E=1.8e-26 PF02770: Acyl-CoA_dh_M" amino acids 132 to 200 (69 residues), 38.4 bits, see alignment E=2.3e-13 PF00441: Acyl-CoA_dh_1" amino acids 227 to 373 (147 residues), 100.9 bits, see alignment E=1.6e-32 PF08028: Acyl-CoA_dh_2" amino acids 243 to 344 (102 residues), 32.1 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_2050)

Predicted SEED Role

"Acyl-CoA dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C889 at UniProt or InterPro

Protein Sequence (377 amino acids)

>CCNA_02129 acyl-CoA dehydrogenase, short-chain specific (Caulobacter crescentus NA1000 Δfur)
MAVLTEEQTMLRDAAKGWASESAPVGALRKLRDSKSKQTFDPAAWAEMGQMGWAGVIVPE
AYDGSAFGYLGLGLILEETGRTLAASPLLSTAMIAASALQLGGSDAQKQAWLPKIATGEA
VATLAIDEGAHHAPARTALSATQSGAGYVLNGTKTLVLDGEAADLLIVAARTSGAPGDTN
GITLFLVAGDAAGVTRSHLSLIDSRGAAKIAFDGVEVGADAVLGEVDKGWAVLEPTLDRA
YAGLAAEMLGSASAAFDITLDYLKTRTQFGQVIGTFQALQHRAAKWFTDLETTRSCVEAA
LEALDAGADSRALAFLAKAKASELVHLASNEMVQMHGGIGMTDAHDAGLYMKRARVTEAL
FGGASFHRDRYARLMGF