Protein Info for CCNA_02113 in Caulobacter crescentus NA1000 Δfur

Annotation: aspartate racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00035: aspartate racemase" amino acids 1 to 221 (221 residues), 156.2 bits, see alignment E=5.3e-50 PF01177: Asp_Glu_race" amino acids 8 to 214 (207 residues), 114.4 bits, see alignment E=3.4e-37

Best Hits

Swiss-Prot: 35% identical to RACD_PYRHO: Aspartate racemase (PH0670) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K01779, aspartate racemase [EC: 5.1.1.13] (inferred from 100% identity to ccr:CC_2033)

Predicted SEED Role

"Aspartate racemase (EC 5.1.1.13)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 5.1.1.13)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.13

Use Curated BLAST to search for 5.1.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C877 at UniProt or InterPro

Protein Sequence (222 amino acids)

>CCNA_02113 aspartate racemase (Caulobacter crescentus NA1000 Δfur)
MSKVLGVLGGMGPAATLDFLAKLQAATPVTREQDHLRVLVDINPKVPDRNVEDSDPGPVL
AAMAAGLRDSGAQVLAIACNTAHAYAEDVRASGLPLIDILETAGLAARAQGASVVGVLGT
SLALGLYRDRFTALGLEVVTLDDHEQVEFMALLYRIKRGDVGRASQDAMAALARRLIDKG
AQAVVAGCTEVPLVLARDDLSAPFLDATQTLAARCVEVCLAG