Protein Info for CCNA_02109 in Caulobacter crescentus NA1000 Δfur

Annotation: thiamine biosynthesis protein thiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 459 to 477 (19 residues), see Phobius details PF13667: ThiC-associated" amino acids 18 to 90 (73 residues), 83.6 bits, see alignment E=6.8e-28 TIGR00190: phosphomethylpyrimidine synthase" amino acids 131 to 579 (449 residues), 698.3 bits, see alignment E=1.6e-214 PF01964: ThiC_Rad_SAM" amino acids 132 to 575 (444 residues), 626.5 bits, see alignment E=2.1e-192

Best Hits

Swiss-Prot: 100% identical to THIC_CAUVC: Phosphomethylpyrimidine synthase (thiC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K03147, thiamine biosynthesis protein ThiC (inferred from 100% identity to ccr:CC_2029)

MetaCyc: 100% identical to HMP-P synthase monomer (Caulobacter vibrioides)
PYRIMSYN1-RXN [EC: 4.1.99.17]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GX84 at UniProt or InterPro

Protein Sequence (612 amino acids)

>CCNA_02109 thiamine biosynthesis protein thiC (Caulobacter crescentus NA1000 Δfur)
MNIQSTIKAVAETISTGPIPGSRKVYQAGELFPELRVPFREVAVHPSANEPPVTIYDPSG
PYSDPAIQIDIEKGLPRTREALVVARGDVEEVADPRQVKPEDNGFAQGKHLAPEFPDTGR
KIYRAKPGKLVTQLEYARAGIITAEMEYVAIRENLRREQDRPCVRDGEDFGASIPDFVTP
EFVRQEIARGRAIIPANINHGELEPMAIGRNFLVKINANIGNSAVLSTVADEVDKLVWAT
RWGADTVMDLSTGRNIHNIRDWIIRNSSVPIGTVPIYQALEKVNGVAEDLNWEVFRDTLI
EQCEQGVDYFTIHAGVRLPFIPMTAKRVTGIVSRGGSIMAKWCLAHHKENFLYERFDEIC
EIMRAYDVSFSLGDGLRPGSTADANDEAQFSELRTLGELTKVAWKHGVQVMIEGPGHVAM
HKIKANMDEQLKHCHEAPFYTLGPLTTDIAPGYDHITSAIGAAMIGWFGTAMLCYVTPKE
HLGLPDRDDVKTGVITYKLAAHAADLAKGHPGAAMWDDAISRARFEFRWEDQFNLGLDPE
TARKFHDETLPKEAHKTAHFCSMCGPKFCSMKISQEVRDFAAGKAPNSAELGMAEMSEKF
REQGSEIYLKTE