Protein Info for CCNA_02071 in Caulobacter crescentus NA1000 Δfur

Annotation: protein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 9 to 89 (81 residues), 84.4 bits, see alignment E=2.2e-28 PF02699: YajC" amino acids 11 to 87 (77 residues), 100.6 bits, see alignment E=1.7e-33

Best Hits

Swiss-Prot: 48% identical to YAJC_BRUAB: Sec translocon accessory complex subunit YajC (yajC) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 100% identity to ccr:CC_1992)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CB17 at UniProt or InterPro

Protein Sequence (103 amino acids)

>CCNA_02071 protein translocase subunit YajC (Caulobacter crescentus NA1000 Δfur)
MPTGSTAATLMNILPIILMVVLFYFMLIRPQQKRQKEHLNMLNNLKRNDTVVLSSGMIGK
IVRVEDREVGVEIATGVTVKVVKGMIAEVRTKGEPAAANDAKN