Protein Info for CCNA_02052 in Caulobacter crescentus NA1000 Δfur

Annotation: topoisomerase IV subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 TIGR01055: DNA topoisomerase IV, B subunit" amino acids 54 to 686 (633 residues), 769.9 bits, see alignment E=9.8e-236 PF02518: HATPase_c" amino acids 80 to 223 (144 residues), 62.4 bits, see alignment E=1e-20 PF00204: DNA_gyraseB" amino acids 277 to 450 (174 residues), 145.2 bits, see alignment E=2.8e-46 PF01751: Toprim" amino acids 478 to 578 (101 residues), 65.3 bits, see alignment E=9.3e-22 PF00986: DNA_gyraseB_C" amino acids 621 to 683 (63 residues), 79.5 bits, see alignment E=3.4e-26

Best Hits

Swiss-Prot: 100% identical to PARE_CAUVC: DNA topoisomerase 4 subunit B (parE) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02622, topoisomerase IV subunit B [EC: 5.99.1.-] (inferred from 100% identity to ccs:CCNA_02052)

Predicted SEED Role

"Topoisomerase IV subunit B (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C9E0 at UniProt or InterPro

Protein Sequence (695 amino acids)

>CCNA_02052 topoisomerase IV subunit B (Caulobacter crescentus NA1000 Δfur)
MSSSDKIPSLFGDDDALAPVPAAPFKASVEPRVEPTPRPIPPPPPSKTASAPGEYSAADI
EVLEGLEPVRKRPGMYIGGTDERALHHLFAEVLDNSMDEAVAGFAKTIEVKLDADGFLSV
KDDGRGMPVDPHPKYPGKSALEVIMTVLHAGGKFTGKAYETSGGLHGVGASVVNALSERV
EVTVWRDGFEHLQVFSRGKPLGPIQQVAPSKKKGTMVRFKPDDEIFGEGTNFKPARLYRM
ARSKAYLFRGVQIKWSCDPSRIHDQTPPEATFHFPNGLADFLAERTKGLTTITPESFAGR
IERQGEAGAVEWAVTWTPQGFGEHDGFMQSYCNTVPTPEGGTHESGFRAALTRGLKAYAE
LKGEKRGTIITADDVVAQAGALISVFIKNPEFQGQTKEKLSTSEAQRFVEASLRDPFDLW
LSSSPKNAQALLEFVIERAEERLKRRKDKEVSRASATRKLRLPGKLADCAGSAVDGAELF
IVEGDSAGGSAKQARDRKYQAILPLRGKILNVASASGEKFTANKELSDLMLALGAQAGAK
YREEDLRYERIIIMTDADVDGAHIASLLITFFYRTMPELIRGGHLFLALPPLYRLAHGGK
SEYARDDAHKEELLATVFKGKKPEIGRFKGLGEMMASQLKETTMDPKKRTLARVTLPRHE
ESVEDLVETLMGRKPELRFRFIQENAEFASADLDL