Protein Info for CCNA_02034 in Caulobacter crescentus NA1000 Δfur

Annotation: luciferase-like monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR03558: luciferase family oxidoreductase, group 1" amino acids 15 to 334 (320 residues), 453.8 bits, see alignment E=1.7e-140 PF00296: Bac_luciferase" amino acids 18 to 311 (294 residues), 150.6 bits, see alignment E=3.5e-48

Best Hits

Swiss-Prot: 57% identical to YHBW_ECOLI: Luciferase-like monooxygenase (yhbW) from Escherichia coli (strain K12)

KEGG orthology group: K00494, alkanal monooxygenase (FMN-linked) [EC: 1.14.14.3] (inferred from 100% identity to ccr:CC_1957)

Predicted SEED Role

"FIG00482463: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8T7 at UniProt or InterPro

Protein Sequence (337 amino acids)

>CCNA_02034 luciferase-like monooxygenase (Caulobacter crescentus NA1000 Δfur)
MRHLADMTSAALPPISVLDLAPVPQGSSVGQALRNSIDLAQHAETLGFHRYWLAEHHNMP
GIASAATAVVIGQIAAATTTIRVGSGGVMLPNHAPLMVAEQFGTLNALYPGRIDLGLGRA
PGTDQATMRALRRYAGAVDSFAQDVVELQHWFKPASTDQSVRAVPGEGQDVPIWILGSST
WGAQLAAALGLPYAFAAHFAPDALIEALTLYRRHFKPSESLDRPYAMVCIGVCAADTDEE
AKRLSTSTQQQFLALRRGRPGLLPPPVDDIREHASPGELAGLDHTLQYAAIGSPETVRRK
IDRVLELTGADELMAAAQIHDHAARRRSYEILASLRA