Protein Info for CCNA_01986 in Caulobacter crescentus NA1000 Δfur

Annotation: lipid-A-disaccharide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 TIGR00215: lipid-A-disaccharide synthase" amino acids 5 to 387 (383 residues), 243.4 bits, see alignment E=1.8e-76 PF02684: LpxB" amino acids 11 to 362 (352 residues), 267.7 bits, see alignment E=7.8e-84

Best Hits

Swiss-Prot: 39% identical to LPXB_MAGSA: Lipid-A-disaccharide synthase (lpxB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00748, lipid-A-disaccharide synthase [EC: 2.4.1.182] (inferred from 100% identity to ccr:CC_1909)

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.182

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7X4 at UniProt or InterPro

Protein Sequence (398 amino acids)

>CCNA_01986 lipid-A-disaccharide synthase (Caulobacter crescentus NA1000 Δfur)
MTINRDKPLKVMLVAAEASGDALGAGLAKALRARLGQGVTFVGIGGAKMAEQGVQSPFDI
AQLSILGILESLKAYPRAMARLKDTVALAAREKPDVAVLIDSWGFNIRLAHALRRLDPTL
PLVKYVAPQVWAYREGRAQALAKAVDLLLSIQPMDKAYFDAAGLQNVFVGNSALAKRFDH
ADPGRLRAAIGAAASQQILLVLPGSRPSEIERVMPAFEDAVRRLKVERPDLHIVVPAAYT
VAEAVKARVAGWPFRAHVIEDEGLKDDAFLAGDVALACSGTVTTELALAGRPMVVGYKTG
AVTYAIVKRLMKPRWITLFNIAAGKAVAPELIQHACEGEGLAREVALRLDDPDLRQRQTA
EQYAALDRMGRGMPDPSEAAAEALLDFLSARGALGRAG