Protein Info for CCNA_01981 in Caulobacter crescentus NA1000 Δfur

Annotation: DNA translocation competence protein ComA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 transmembrane" amino acids 38 to 55 (18 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 284 to 311 (28 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 354 to 380 (27 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details amino acids 428 to 450 (23 residues), see Phobius details amino acids 459 to 482 (24 residues), see Phobius details amino acids 492 to 512 (21 residues), see Phobius details amino acids 524 to 543 (20 residues), see Phobius details PF13567: DUF4131" amino acids 62 to 212 (151 residues), 53 bits, see alignment E=3.4e-18 PF03772: Competence" amino acids 261 to 546 (286 residues), 223 bits, see alignment E=4.8e-70 TIGR00360: ComEC/Rec2-related protein" amino acids 282 to 477 (196 residues), 72.9 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to ccr:CC_1904)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7W9 at UniProt or InterPro

Protein Sequence (725 amino acids)

>CCNA_01981 DNA translocation competence protein ComA (Caulobacter crescentus NA1000 Δfur)
MLIQSASPDRQASTPEAAGAPAARWALTAELANNLDRRFLWAPVAFGLGAAAYLEVRVEP
ALWGLTLLAGVIGLAAWGARRWNAPPLLVVLLGLIAFGAAGAWAAKVRSERVAAPVMDGE
RIVRRVDGFVVDVVSPGAGGQRLLIAPVRVSGLSPEDTPRRIRVTIGENPVRKPGQAIGL
RAMLGPPPPPAAPGAYDFARDAWFDSIGGVGFAIGDIGEVTLDQPPLRLRLVMAVNAFRW
DLAQRLLARMGPTSGGIGAAMVTGHEAWISETQTEAMRASGLAHILSISGLHMAIVGGFV
FVVVRMGVAAWPWLALRAPGKKIAASAGLVSVLGYLIVSGAPPPAERAAITASVAFLAIL
FDRRAITLHGLALAALSILLLKPETAGEPGFQMSFAATAALVALAESWPKPVRELSTPWW
IQGPQAIATWLAVSIAASLVAGLATAPFAMQHFNRVAVWGLPANLAVSPLSSFVIMPFLA
IGTVLEPFGLSAPFLAVAGWGIDVMLNVAGLFSEAHGAQHIVASAPPQVLLVAFLGLMVL
CLWRGRLRWIGAPLALAVALWPRPTPPDAWIAADGATAAVRSGNAAVLLRTDAKRFGAEL
WARRRGLEPTTWNLYGCDRWICAPGLGAPVRLSLAWSRRTPDAETLSGLCVLSDVVVVRG
PAPARTPPLCADTVLLTGDDFARYGAAELYRRSDGWRIVWAQPLRGVRPWSGLLTVRDAR
GAREP