Protein Info for CCNA_01978 in Caulobacter crescentus NA1000 Δfur

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF13489: Methyltransf_23" amino acids 75 to 210 (136 residues), 31.6 bits, see alignment E=3.8e-11 PF13847: Methyltransf_31" amino acids 78 to 200 (123 residues), 41.7 bits, see alignment E=3e-14 PF01209: Ubie_methyltran" amino acids 78 to 198 (121 residues), 21.4 bits, see alignment E=4.2e-08 PF13649: Methyltransf_25" amino acids 83 to 195 (113 residues), 57.8 bits, see alignment E=4.5e-19 PF08242: Methyltransf_12" amino acids 84 to 196 (113 residues), 47.1 bits, see alignment E=9.7e-16 PF08241: Methyltransf_11" amino acids 84 to 198 (115 residues), 61.9 bits, see alignment E=2.3e-20

Best Hits

Swiss-Prot: 42% identical to Y1498_MYCTU: Uncharacterized protein Rv1498c (Rv1498c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1901)

Predicted SEED Role

"FIG00480764: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C980 at UniProt or InterPro

Protein Sequence (283 amino acids)

>CCNA_01978 methyltransferase (Caulobacter crescentus NA1000 Δfur)
MRVLLNTLRTLAPRQIRSVINRLRSSPRGTLAPTSDTPVEPGTIQAPQALWSLVGAADAD
FVRVGQQFKALFLDAGLKPHHAILDVGCGIGRAAAPLVDYLDDNGRYAGFDVMAEAIDWC
RANIAVGDPRFEFLHADMHSDRYNPSGTQPASAYVFPYPDASFDYVWLGSVFTHLLAADQ
SQFAREIVRVLKPGGISIVSWYLIDDEARANTGQGRIAFDFIHPLDGCWTATPDLPEAVI
GYDLALIQEQYKGLGLEILNEALGVWRREPIQDQDIIVARKSP