Protein Info for CCNA_01950 in Caulobacter crescentus NA1000 Δfur

Annotation: peptide chain Release factor 2 (RF-2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR00020: peptide chain release factor 2" amino acids 18 to 359 (342 residues), 494.6 bits, see alignment E=8.1e-153 PF03462: PCRF" amino acids 27 to 214 (188 residues), 188.3 bits, see alignment E=1.4e-59 PF00472: RF-1" amino acids 223 to 333 (111 residues), 150 bits, see alignment E=2.6e-48

Best Hits

Swiss-Prot: 100% identical to RF2_CAUVC: Peptide chain release factor 2 (prfB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 100% identity to ccr:CC_1874)

Predicted SEED Role

"Peptide chain release factor 2; programmed frameshift-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8GWM3 at UniProt or InterPro

Protein Sequence (371 amino acids)

>CCNA_01950 peptide chain Release factor 2 (RF-2) (Caulobacter crescentus NA1000 Δfur)
MSRPLRPTSSSPWDCSGGVFDWDVALRKLDELNARVEDPTLWDRPSEAQAVSRERANLAA
KVEAVQSIERDLKDALEYAELAEMESDEDSLNDARAQLKSLKERAGRAELEALLSGEADG
NDCYVEINSGAGGTESCDWAGILLRMYTRWANAHGMTTELIEETDGDQAGIKSATLLVKG
ANAYGWLKTEAGVHRLVRISPYDSSARRHTSFASAWVYPVVDDNIEIEINPSDVRTDTYR
ASGAGGQHINKTDSAVRLTHIPTGIAVACQAGRSQHQNREEAWKMLRARLYEAELQKREA
AQQALEDQKTDIGWGHQIRSYVLQPYQMVKDLRTNVETSDTQGVLDGDLDAFMAASLAQR
VGHTRDGGEAS