Protein Info for CCNA_01943 in Caulobacter crescentus NA1000 Δfur

Annotation: alpha/beta hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF02129: Peptidase_S15" amino acids 18 to 154 (137 residues), 39.5 bits, see alignment E=1.1e-13 PF00561: Abhydrolase_1" amino acids 48 to 139 (92 residues), 27.4 bits, see alignment E=5.3e-10

Best Hits

Swiss-Prot: 49% identical to Y471_RICPR: Uncharacterized protein RP471 (RP471) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K07018, (no description) (inferred from 99% identity to cse:Cseg_2154)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8L2 at UniProt or InterPro

Protein Sequence (216 amino acids)

>CCNA_01943 alpha/beta hydrolase family protein (Caulobacter crescentus NA1000 Δfur)
MPDVILTGASGRIEGRYSPGKTETAPIALILHPHPKAGGHMNHPVSVQLYHLFMKRGFAT
LRFNFRGVGRSQGEFDAGIGELADAATALDWLQTSNPAASQTWVAGFDFGAYIGMQLLMR
RPETDGFISVSPPTNMYDFSFLAPCPASGLFLTGSADTITPPVEVERVVTKLRTQKGITI
DYEVIDKATHFWAEHLPSVEKSVSDYLDKRLAENPI