Protein Info for CCNA_01934 in Caulobacter crescentus NA1000 Δfur

Annotation: HesB protein family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 20 to 123 (104 residues), 116.3 bits, see alignment E=3.6e-38 PF01521: Fe-S_biosyn" amino acids 20 to 120 (101 residues), 67.9 bits, see alignment E=4.4e-23

Best Hits

Swiss-Prot: 53% identical to Y484_RICPR: Uncharacterized protein RP484 (RP484) from Rickettsia prowazekii (strain Madrid E)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 100% identity to ccs:CCNA_01934)

Predicted SEED Role

"Iron binding protein SufA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C942 at UniProt or InterPro

Protein Sequence (133 amino acids)

>CCNA_01934 HesB protein family (Caulobacter crescentus NA1000 Δfur)
MEPMEPTIAVRPRRPRPKVVTLTDAAAARVKEIMDKADQPYAGLRVGVKNGGCAGQEYVF
EYAKEKGPIDEVVEDKGVTILIEPKAVLFLVGTEIDYEVTKLSSKFVFHNPNETDACGCG
ESVTIQPAAEALD