Protein Info for CCNA_01875 in Caulobacter crescentus NA1000 Δfur

Annotation: acyl-CoA dehydrogenase, short-chain specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF02771: Acyl-CoA_dh_N" amino acids 7 to 116 (110 residues), 88.3 bits, see alignment E=9.4e-29 PF02770: Acyl-CoA_dh_M" amino acids 120 to 216 (97 residues), 95.7 bits, see alignment E=3.1e-31 PF00441: Acyl-CoA_dh_1" amino acids 228 to 375 (148 residues), 161.7 bits, see alignment E=2.9e-51 PF08028: Acyl-CoA_dh_2" amino acids 245 to 365 (121 residues), 86 bits, see alignment E=5.7e-28

Best Hits

KEGG orthology group: K06446, acyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 100% identity to ccs:CCNA_01875)

MetaCyc: 58% identical to medium-chain acyl-CoA dehydrogenase (Cupriavidus necator H16)
RXN-22997 [EC: 1.3.8.7]

Predicted SEED Role

"Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)" in subsystem Isoleucine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.- or 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAI5 at UniProt or InterPro

Protein Sequence (381 amino acids)

>CCNA_01875 acyl-CoA dehydrogenase, short-chain specific (Caulobacter crescentus NA1000 Δfur)
MTDPDTLSALIDVIQRFVAERLRPIEGLVSETDEVPGSIIEEMKQLGLFGLSIPESYGGL
GLSLEEEARVIVAFCHTAPAFRSTFGTNVGIGSQGLVMFGDEAQKARWLPSIASGETITA
FALTEAEAGSDSASVQTRAVRDGDHYVLNGVKRYITNAGRANLFTVMARTDPNTKGGAGV
SAFLVPADLPGLSVGKPEKKMGQQGAHIHDVVFEDVRVPVENRLGAEGEGFTVAMRVLDR
GRVHISAVCVGVAERLIADCVAYASERKQFGQPIASFQLIQAMIADSKTEALAAKALVFD
TARKRDAGANVTLEAAATKLFASEMVGRVADRAVQVFGGAGYVADYGIERLYRDVRIFRI
YEGASQIQQLIIARETLKRGG