Protein Info for CCNA_01850 in Caulobacter crescentus NA1000 Δfur

Annotation: quinol cytochrome oxidase polypeptide I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 665 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 198 to 221 (24 residues), see Phobius details amino acids 235 to 261 (27 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 353 to 376 (24 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 423 to 448 (26 residues), see Phobius details amino acids 461 to 482 (22 residues), see Phobius details amino acids 501 to 526 (26 residues), see Phobius details amino acids 588 to 615 (28 residues), see Phobius details amino acids 617 to 637 (21 residues), see Phobius details TIGR02843: cytochrome o ubiquinol oxidase, subunit I" amino acids 10 to 654 (645 residues), 1153.2 bits, see alignment E=0 PF00115: COX1" amino acids 64 to 512 (449 residues), 498.3 bits, see alignment E=9.7e-154

Best Hits

Swiss-Prot: 68% identical to CYOB_ECOL6: Cytochrome bo(3) ubiquinol oxidase subunit 1 (cyoB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02298, cytochrome o ubiquinol oxidase subunit I [EC: 1.10.3.-] (inferred from 100% identity to ccr:CC_1772)

MetaCyc: 68% identical to cytochrome bo3 subunit 1 (Escherichia coli K-12 substr. MG1655)
RXN-21817 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8Y3 at UniProt or InterPro

Protein Sequence (665 amino acids)

>CCNA_01850 quinol cytochrome oxidase polypeptide I (Caulobacter crescentus NA1000 Δfur)
MSPDLVQFIFGRLTWDAIPLHDPILLVTFAVVALGGVTVLALLTRYKLWGYLWREWLTSV
DHKKIGVMYIILALIMLLRGFADALMMRAQQAMAFGDATGYLPPEHYDQIFTAHGVIMIF
FVAMPLVTGLMNLVVPLQIGARDVSFPFLNNFSFWMTVGGAVLVMASLFVGEFARTGWLA
YPPLSNIAYSPGVGVDYYIWALQIAGVGTLLSGINLVVTIVKMRAPGMSLMKMPVFTWTA
LCTNVLIVAAFPILTAVLGLLSADRYLGTNFFTNDFGGNPMMYVNLIWIWGHPEVYILIL
PAFGVFSEVVSTFCRKRLFGYSSMVYATVVITLLSYIVWLHHFFTMGSGASVNAFFGITT
MIISIPTGAKIFNWLFTMYRGRIRFEVPMLWTVGFMVTFVIGGMTGVLLAIPPADFVLHN
SLFLIAHFHNVIIGGVVFGMFAGIVYWFPKAFGFRLDPFWGKLSFWFWLSGFYFAFMPLY
VLGLMGVTRRVSHFEDPSLQIWFVIAAFGAVLILLGIIAFIVQIVVSIRNREALRDETGD
PWDGRTLEWSTSSPPPAYNFAFTPMVHDLDAWWDMKQRGYVRPTSGFIPIHMPANTGAGV
VLAGLSVVCGFAMIWHIWWLAVLSFIALVGAAIAHTFNFKRDYYIPAEEVVRVEDARTEA
LRSLT