Protein Info for CCNA_01847 in Caulobacter crescentus NA1000 Δfur

Annotation: cytochrome c oxidase assembly protein Surf1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details PF02104: SURF1" amino acids 19 to 223 (205 residues), 191.3 bits, see alignment E=1.3e-60

Best Hits

KEGG orthology group: K14998, surfeit locus 1 family protein (inferred from 100% identity to ccs:CCNA_01847)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Surf1, facilitates heme A insertion" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAG2 at UniProt or InterPro

Protein Sequence (245 amino acids)

>CCNA_01847 cytochrome c oxidase assembly protein Surf1 (Caulobacter crescentus NA1000 Δfur)
MKPRLIAKTTALVSLCVGFAVLFAGLGVWQLQRRVWKLDLIAQVEQRLAAPPVGAPGPLD
WPHLAPANDVYRRVVLSGVFDHDRETLTQAVTVLGPGFWVLTPLRTDQGFTVLVNRGFVP
AERAAASRRAAGQVRGEIRVVGLLRFTEPGGGFLRRNQPAAGRWYSRDVAAIAQSRGLGV
VAPYFVDADGAPNPGGWPRGGLTVVRFPNSHLIYALTWFALALFSAGAAAYVLADARRSR
REDAA