Protein Info for CCNA_01846 in Caulobacter crescentus NA1000 Δfur

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details PF02518: HATPase_c" amino acids 339 to 440 (102 residues), 55.7 bits, see alignment E=3.3e-19

Best Hits

KEGG orthology group: K15011, two-component system, sensor histidine kinase RegB [EC: 2.7.13.3] (inferred from 100% identity to ccr:CC_1768)

Predicted SEED Role

"Sensor histidine kinase PrrB (RegB) (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C988 at UniProt or InterPro

Protein Sequence (448 amino acids)

>CCNA_01846 two-component sensor histidine kinase (Caulobacter crescentus NA1000 Δfur)
MTPTANLVLSGVSGWLSGARAAENANGPADAIARQNMLQLIHLRWIAVAGQVVTILVVHF
SFGFPLPLAAMMLVLLALVVLNLLSLLRLKRVEPLGRYELFAALAIDALALTIQLYFSGG
ATNPFTTLYLLHVILGAVLLEARATWAIVALISFFFVALIGFNRPIIAPGLSDRAFFELY
IMGMLVGLLLDAVLLVTFVGRINTNLRSHDARLAELRQREAEEAHIIRMGLLASGAAHEL
GTPLATLDVILGDWRRVPAIASNAELAQELEDMRGEVRRCKAIVTGVLLSAGEARSGEVR
VSTLRGFMDEVVAEWRASRADAPLLYETDLRDATPIIAESTLKQGIHNILDNALEASGSA
LRLSAATRDGWIRIVVEDDGPGFTSEALADFGKPYNSTKGRAGSGLGLFLLVNVLRKLGG
VAEAENLVGGARVSIRLPVAMLEVARHG