Protein Info for CCNA_01818 in Caulobacter crescentus NA1000 Δfur

Annotation: D-alanine aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF01063: Aminotran_4" amino acids 31 to 256 (226 residues), 146.7 bits, see alignment E=4.9e-47

Best Hits

KEGG orthology group: K00824, D-alanine transaminase [EC: 2.6.1.21] (inferred from 100% identity to ccs:CCNA_01818)

Predicted SEED Role

"D-alanine aminotransferase (EC 2.6.1.21)" in subsystem Pyruvate Alanine Serine Interconversions (EC 2.6.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CAD9 at UniProt or InterPro

Protein Sequence (287 amino acids)

>CCNA_01818 D-alanine aminotransferase (Caulobacter crescentus NA1000 Δfur)
MSRFAYVNGRFVRHGEAAVHIEDRGYQLADGVYEVWAVFDGKLADAEGHFARLWRSLDEL
RIAHPMSEAALTMVLREAVRRNKVREGLCYLQVTRGVARRDHAFPNPAVLPSVVVTARSL
DRAASEAKAAQGASVISVQENRWGRCDIKSIGLLPNALAKQAARERGAIEAWFVDDMGLV
TEGASSNAWIVDAEGALRTRDTNANILRGVTRYTLLDVIRESGMVINEKPFTIAEAQSAR
EAFITGAGSLVTPIVQVDGVKLGDGKPGPVAKRLRALYIERARQKAV