Protein Info for CCNA_01816 in Caulobacter crescentus NA1000 Δfur

Annotation: nitrogen regulation protein ntrY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 62 to 87 (26 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details PF19312: NtrY_N" amino acids 37 to 309 (273 residues), 83.4 bits, see alignment E=5.9e-27 PF00672: HAMP" amino acids 328 to 378 (51 residues), 40.2 bits, see alignment 1e-13 PF13188: PAS_8" amino acids 397 to 453 (57 residues), 21.7 bits, see alignment 4.5e-08 PF00512: HisKA" amino acids 509 to 575 (67 residues), 41.3 bits, see alignment E=3.9e-14 PF02518: HATPase_c" amino acids 619 to 732 (114 residues), 70.9 bits, see alignment E=3.5e-23

Best Hits

KEGG orthology group: K13598, two-component system, NtrC family, nitrogen regulation sensor histidine kinase NtrY [EC: 2.7.13.3] (inferred from 100% identity to ccs:CCNA_01816)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8W0 at UniProt or InterPro

Protein Sequence (747 amino acids)

>CCNA_01816 nitrogen regulation protein ntrY (Caulobacter crescentus NA1000 Δfur)
MSSVAYATGSDSPPTRFSRAWWRGVLRSRYLMGGGYALAVILTVTGVALASSPPRTDSIG
AASTVILVVLGFNLVLILGVATIVGLRLYELIDARASDAGARLHLRFVGLFSLAAVAPAV
IVALFFGVLVNRGVDGWFSERVQTVVGNSAKVANSYVEQQKNYISEHIGPMAASLNQAAP
ALAQSPVAFGHFLAGLTQDNGFSAAYVLDRDGRILARTEAEGAPPFLAPPPASFDWADGG
EASAQRFVSTDLFRTLYKLKGFDDGYLYVVRPIEKGILNHLIETQDALVSYRDAERSRGR
IQAIFGLSYLETALLVLVAAIWVGIAAANSIAGPVAGLVEAAGRVSGGDLDARVEVERGP
EEIRALSNAFNMMTSELQLQQAALKAASLDAESRRQFIETVLSGVSAGVVSLDDRGKISA
VNRRAVALLGLPDDALGVDLIALAPEFETVMTSLSESRPDTDVEVDIMREGETRRLRVRA
AGHFAEGLVLTFDDITRLVAAQRNAAWKDVARRIAHEIKNPLTPIQLSAERLRRKYRKEI
ASDLETFDRCTDTIIRQVGDIGRMVDEFSAFARMPAPRFEPSNLTEMLRQAVFAQRFQDA
EIEVRLEEPGDGDVWITSDERMVGQALTNILKNAGEAVGARRANEPELQGRITATLVCEG
DELCVTVEDNGVGLPAKDRDRLTEPYVTTREKGTGLGLAIVKRIMEDHGGSLALVDAREP
PGARVVMKFPTTARLPVAAQSGVEEMI