Protein Info for CCNA_01791 in Caulobacter crescentus NA1000 Δfur

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 2 to 542 (541 residues), 747.9 bits, E=2.9e-229
• PF06418: CTP_synth_N
  • amino acids 3 to 270 (268 residues), 410.1 bits, E=5.9e-127
• PF00117: GATase
  • amino acids 306 to 541 (236 residues), 133.2 bits, E=1.4e-42

Best Hits

Swiss-Prot: 100% identical to PYRG_CAUVN: CTP synthase (pyrG) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to ccs:CCNA_01791)

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See B8GW64 at UniProt or InterPro

Protein Sequence (550 amino acids)

>CCNA_01791 CTP synthase (Caulobacter crescentus NA1000 Δfur)
MTRYIFITGGVVSSLGKGLASAALGALLQARGYKVRLRKLDPYLNVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFTGVSATKADNITTGQIYKTIIEKERRGDYLGATVQVIPHVTN
EIKDFVLSPAMDETGEKAVDFVLVEIGGTVGDIEGLPFFEAIRQLRQDLPRGQSCYVHLT
LLPFIKTAGEMKTKPTQHSVKELRSIGIQPDILLCRCEQEIPPEEKRKIAQFCNVRPSAV
IQAMDSSSIYAVPIDYHEQGLDAEVLDVFGMRDAPAPDLTRWKTIDDTVQHPDGEVTIAV
VGKYTVLKDAYKSLIEALHHGGLANKVKVNLDWVESETFEGDEGAAAARLENAHAIMVPG
GFGERGAEGKIRAAQFARERKVPYFGICFGMQMAVIETLRNVAGIKDASSSEFGPTERPV
VGIMTEWIKGNETVQRRANDDLGGTMRLGAYDAVLTAGSKIAEIYGATEISERHRHRYEV
NIGYVHLMEDAGLKLTGRSPNGVLPEIVERDDHPWFIGVQYHPELKSRPFAPHPLFASFI
AAAKEHGRLV