Protein Info for CCNA_01773 in Caulobacter crescentus NA1000 Δfur

Annotation: SNARE-associated family membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 18 to 53 (36 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details PF09335: VTT_dom" amino acids 39 to 163 (125 residues), 66.9 bits, see alignment E=1.2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1701)

Predicted SEED Role

"conserved hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C876 at UniProt or InterPro

Protein Sequence (205 amino acids)

>CCNA_01773 SNARE-associated family membrane protein (Caulobacter crescentus NA1000 Δfur)
MDAFLNQTFALAADNSLLAGGLLFVLTLLEALLVVGVLIPIVGVMLAAGALVAQGVMHPV
EAVLWCSAGAAVGDALSYLLGHRLGGRHGARMLFSGRRRLFARAKLLARRYGTVAIIAAR
YLGPVRPMIPILAGMSRARPWRFHIASALTAPIWVVSLMAPGYLAVVNLQRLDLDPGVAG
PLAVAALIIVATIWLAFQRPRAVLA