Protein Info for CCNA_01737 in Caulobacter crescentus NA1000 Δfur

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00665: replicative DNA helicase" amino acids 24 to 492 (469 residues), 507.2 bits, see alignment E=1.8e-156 PF00772: DnaB" amino acids 24 to 124 (101 residues), 93.4 bits, see alignment E=1.2e-30 PF03796: DnaB_C" amino acids 203 to 490 (288 residues), 337.8 bits, see alignment E=6e-105 PF13481: AAA_25" amino acids 215 to 396 (182 residues), 47.7 bits, see alignment E=2.2e-16

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to ccs:CCNA_01737)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7A8 at UniProt or InterPro

Protein Sequence (507 amino acids)

>CCNA_01737 replicative DNA helicase (Caulobacter crescentus NA1000 Δfur)
MPMSLVPALDLVLPGLPEPTINVAPHNMEAEQALLGVLLYDNAAYERLSDNLQARCFYEP
FHQRLFQAIETHVRKGQLAEPILLADEFKKDPAFEELGGLRYLADLVDRAPPAANVGDYA
RVIFDLSLRRELIRIGGDIATAAQGGNDEKRNARDQIEAAEQSLYSLAESGAASSGFVSF
GDALRGAVEMTAEAYSRDGGMSGVSTDLMDLDQKIGGLHPSDLIILAGRPSMGKTALATN
IAFNIAKKYAYEIQPDGTKKTVQGGVVAFYSLEMSAEQLALRMLADASGVSGDRLRKGEI
DASEFGRVRDAAMELQNAPLYIDATGGISIAKLTARARRLKRQVGLDLIVVDYLQLVTGS
DLGANANRVQEVSQITMGLKALAKELSVPVIALSQLSRQVEQRDDKRPQLSDLRESGSIE
QDADMVWFVYREAYYVGRAEPREGTPEHLTWQEEMDRLQGLAEVIIAKQRHGPIGTVRLS
FNSDTTRFGNLARDHYFAQARNIPSDE