Protein Info for CCNA_01732 in Caulobacter crescentus NA1000 Δfur

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR00416: DNA repair protein RadA" amino acids 1 to 447 (447 residues), 531.4 bits, see alignment E=9.1e-164 PF18073: Zn_ribbon_LapB" amino acids 8 to 35 (28 residues), 38.3 bits, see alignment (E = 2.5e-13) PF06745: ATPase" amino acids 73 to 141 (69 residues), 41.5 bits, see alignment E=3.1e-14 PF13481: AAA_25" amino acids 85 to 221 (137 residues), 55.8 bits, see alignment E=1.5e-18 PF00004: AAA" amino acids 93 to 184 (92 residues), 22.6 bits, see alignment E=3.9e-08 PF13541: ChlI" amino acids 340 to 423 (84 residues), 32 bits, see alignment E=3.1e-11

Best Hits

Swiss-Prot: 60% identical to RADA_BRUA2: DNA repair protein RadA (radA) from Brucella abortus (strain 2308)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to ccs:CCNA_01732)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7A4 at UniProt or InterPro

Protein Sequence (460 amino acids)

>CCNA_01732 DNA repair protein RadA (Caulobacter crescentus NA1000 Δfur)
MARDGAVYACQSCGAVQTKWSGQCSACQSWNTLVEEVSAKPPGALSATKATRVRGLQFTG
LESETAPPPRILTGVDEFDRVCGGGVVPGSALLIGGDPGVGKSTLLLQVCASAAARGVSC
AYISGEEAVEQIRGRADRMGLAKANVSLAAETALRDILDGLKRDNFDLVVIDSIQTMWSD
AHEAGPGTVTQVRACATELVRLAKKKGVAILLVGHVTKDGQIAGPRVVEHLVDAVLSFEG
ERGYPFRILRGAKNRFGATDEIGVFEMGDVGLREVKNPSALFLNEGGERAAGAAVFAGIE
GSRPVLVEFQALVAPSAYGTPRRAVVGWDSGRLAMVLAVLEARCGLGFGDKDVYLNVAGG
LRITEPAADLAAAAALASSALDVALPQDCVVFGELSLSGEVRPVSRMETRLKEAAKLGFG
RALGPLAGLPEGGGALPVAGVARLTDAVRRIGDEIWTSLT