Protein Info for CCNA_01729 in Caulobacter crescentus NA1000 Δfur

Annotation: transporter, sodium/bile acid symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details PF13593: SBF_like" amino acids 24 to 329 (306 residues), 345.4 bits, see alignment E=3.2e-107 PF01758: SBF" amino acids 55 to 227 (173 residues), 55.7 bits, see alignment E=5.6e-19

Best Hits

Swiss-Prot: 56% identical to Y2026_PSEAE: Uncharacterized protein PA2026 (PA2026) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 100% identity to ccr:CC_1657)

Predicted SEED Role

"Sodium/bile acid symporter family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8P0 at UniProt or InterPro

Protein Sequence (337 amino acids)

>CCNA_01729 transporter, sodium/bile acid symporter family (Caulobacter crescentus NA1000 Δfur)
MPGGTRILSMGFKSLLDKLKIEPYVIALFGMVVLASVLPVRGAAAEGLSVIVKLAIALLF
FLHGAKLSREAVVAGVTHWRLHLTILAFTFVMFPVLGLVASKLGVLSSTLAAGMLFLCCL
PSTVQSSIAFTSIARGNVAAAVCAASASNLFGIFITPVLVSVLMHTQGGAAGGWESIQDI
IVQLLLPFILGQLARPLVAKWVEKHKQLVGYVDRGSILLVVYAAFSEAVVGGIWSKVSAL
EMVVLLVACCILLAIVLAATTYGARALGFSKEDEITIMFCGSKKSMATGVPMAGILFPGP
TAGVIVLPLMIFHQIQLMACSVIAQHYAKRPSEIVEA