Protein Info for CCNA_01727 in Caulobacter crescentus NA1000 Δfur

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 TIGR00229: PAS domain S-box protein" amino acids 25 to 138 (114 residues), 43.5 bits, see alignment E=1.6e-15 PF08448: PAS_4" amino acids 30 to 135 (106 residues), 48.7 bits, see alignment E=2e-16 PF00989: PAS" amino acids 32 to 126 (95 residues), 26.3 bits, see alignment E=1.6e-09 PF13426: PAS_9" amino acids 34 to 134 (101 residues), 39.4 bits, see alignment E=1.6e-13 PF08447: PAS_3" amino acids 42 to 128 (87 residues), 49.2 bits, see alignment E=1.3e-16 PF00015: MCPsignal" amino acids 263 to 419 (157 residues), 186.5 bits, see alignment E=9.7e-59

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to ccs:CCNA_01727)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7A0 at UniProt or InterPro

Protein Sequence (501 amino acids)

>CCNA_01727 methyl-accepting chemotaxis protein (Caulobacter crescentus NA1000 Δfur)
MALFSIGRDTGDQANRICELEGIVAAIQRSQAVIEFNLDGSIITANDNFLRAVGYGLGEI
QGRHHSLFVDPAFAAGAEYRDFWQRLKAGEFLTGKYKRVGKGGREIWIQATYNPVFDRHG
KLAKVIKFAADVTAAETERLESERERDAMRQEQDEIVSALANSLQRLAQGDLTVRIDAHF
DARHDRLKADFNAAVDSLKDAMGAIAEAAGGMESGAVEIASASNDLSKRTEQQAASLEET
AAALDEITATVKRSADGAKQASAAASSASREADRSGEVVREAVSAMGEIEKSSGQITQII
GVIDEIAFQTNLLALNAGVEAARAGDAGRGFAVVAQEVRALAQRSAEAAKEIKQLIASST
AQVERGVRLVGDTGQALTAIVAKVGEIDTLIREIAESAQEQATGLNEVNSAVNQMDQVTQ
QNAAMVEQATTSAAQLRGEAQDLARQVSRFQTGASYVAQRPQAAAPRPEPTMAAPRARIQ
ASARPGSAAVAVAPSSDWEEF