Protein Info for CCNA_01688 in Caulobacter crescentus NA1000 Δfur

Annotation: potassium channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 73 to 97 (25 residues), see Phobius details PF07885: Ion_trans_2" amino acids 26 to 98 (73 residues), 53.7 bits, see alignment E=2.4e-18 PF02254: TrkA_N" amino acids 121 to 236 (116 residues), 124.5 bits, see alignment E=4.3e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccs:CCNA_01688)

Predicted SEED Role

"Potassium channel protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA15 at UniProt or InterPro

Protein Sequence (347 amino acids)

>CCNA_01688 potassium channel protein (Caulobacter crescentus NA1000 Δfur)
MRRGERVIGGLIARPFRNLAFAVAFVLAVAGMAVLAYMRAGWSFGDALYMVTLTIFTVGY
GEVRPVDTDDLRAVTMATMVFGCTGVIIVTGALVQALTQSQLEQFFGKRVERDIEKLDGH
IVICGFGRIGLMLASELAAAGERFVVVERDEARCDEARELGYLCRHADATDEDVLRAMHV
ERAKVLATVLPDDAANVFITLSARSLNPKIEIIARGERPTTERKLIQAGADKVVMPAHIG
AERIAEMILYPRLAGFLKEARAPAAQQSEALAQLGLDLGLVTAPASFAARRVTVGEFERR
GGVLVVRIERANGALIEKPKADEVIGAGDGLAVLSKLGRLGLDAITD