Protein Info for CCNA_01678 in Caulobacter crescentus NA1000 Δfur

Annotation: arginine N-succinyltransferase, beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF04958: AstA" amino acids 1 to 332 (332 residues), 415.1 bits, see alignment E=7.7e-129 TIGR03243: arginine and ornithine succinyltransferase subunits" amino acids 3 to 333 (331 residues), 430.7 bits, see alignment E=1.6e-133

Best Hits

Swiss-Prot: 42% identical to ASTA_ECOLU: Arginine N-succinyltransferase (astA) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K00673, arginine N-succinyltransferase [EC: 2.3.1.109] (inferred from 100% identity to ccr:CC_1606)

MetaCyc: 42% identical to arginine N-succinyltransferase (Escherichia coli K-12 substr. MG1655)
Arginine N-succinyltransferase. [EC: 2.3.1.109]

Predicted SEED Role

"Arginine N-succinyltransferase (EC 2.3.1.109)" in subsystem Arginine and Ornithine Degradation (EC 2.3.1.109)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.109

Use Curated BLAST to search for 2.3.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3CA03 at UniProt or InterPro

Protein Sequence (334 amino acids)

>CCNA_01678 arginine N-succinyltransferase, beta chain (Caulobacter crescentus NA1000 Δfur)
MLVVRPAGSADFEALMELAVLSGRGFTSLPEDEPTLRSRLALSEASFQAGVAPPEAWYTL
MLEDLETGTVEGVAGVKAGVGLKRPFFSFRVVTLAQSSPTLEMRFDHKALVLVNECAGWS
EVGSLFLRPEKRKGGAGRLLAQSRYMLIGIEPQRFAEMVLAELRGWFDEDGRCPFWEHVS
HKFFRLDFDQADLMSASTDGQFILDLAPRHPIYTELLPEEARDVIGRVHRDGEAARAMLE
REGFRYQGLVDLFDAGPTVACPRDDIRTVRDARRLRVKVGEDAYGEEALISTGEVSRFRA
VRAPVLIDGETAILGRDAMDALGVGEGEVVRVKA