Protein Info for CCNA_01641 in Caulobacter crescentus NA1000 Δfur

Annotation: 2-nitropropane dioxygenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF03060: NMO" amino acids 10 to 69 (60 residues), 44.7 bits, see alignment E=1.8e-15 amino acids 80 to 292 (213 residues), 133.3 bits, see alignment E=2.1e-42 PF01070: FMN_dh" amino acids 116 to 196 (81 residues), 38.4 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1570)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C7X3 at UniProt or InterPro

Protein Sequence (311 amino acids)

>CCNA_01641 2-nitropropane dioxygenase family protein (Caulobacter crescentus NA1000 Δfur)
MTNRVLAHTGAKYPIIQAPMGWIARYQLASAVSRAGGLGIIETSSGETENCKAEITKMAQ
SGLPFGVNLPIMFLRDDAMLRFVCDSGVKFVTTSAGSPAKFIGPLKDAGIVVYHAVPTVD
AAVKCVEAGVDGLVVEGAEGGGFKNPEEVSTLVLLQAIREKVDVPLVAAGGICDGRGMAA
AFALGAEAVQMGTRFVSSAESPVHDNYKAAITGAKETGTWVLNKKASPCIRAIKSELTKE
IHDAGVMPPDVLKNILGVYFGGDMEAAPALAGQTVGLINEVKSAHDIIDETVAQFHQITG
RLGALAAARGF