Protein Info for CCNA_01637 in Caulobacter crescentus NA1000 Δfur

Annotation: topoisomerase IV subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 759 TIGR01062: DNA topoisomerase IV, A subunit" amino acids 22 to 756 (735 residues), 799.6 bits, see alignment E=1.3e-244 PF00521: DNA_topoisoIV" amino acids 42 to 475 (434 residues), 494.6 bits, see alignment E=2.6e-152 PF03989: DNA_gyraseA_C" amino acids 570 to 617 (48 residues), 15.8 bits, see alignment 7.8e-07 amino acids 624 to 654 (31 residues), 6.6 bits, see alignment (E = 0.00059) amino acids 667 to 704 (38 residues), 26.2 bits, see alignment 4.3e-10

Best Hits

Swiss-Prot: 100% identical to PARC_CAUVC: DNA topoisomerase 4 subunit A (parC) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02621, topoisomerase IV subunit A [EC: 5.99.1.-] (inferred from 100% identity to ccs:CCNA_01637)

Predicted SEED Role

"Topoisomerase IV subunit A (EC 5.99.1.-)" in subsystem DNA topoisomerases, Type II, ATP-dependent or Resistance to fluoroquinolones (EC 5.99.1.-)

Isozymes

Compare fitness of predicted isozymes for: 5.99.1.-

Use Curated BLAST to search for 5.99.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8F5 at UniProt or InterPro

Protein Sequence (759 amino acids)

>CCNA_01637 topoisomerase IV subunit A (Caulobacter crescentus NA1000 Δfur)
MNKPVLPPPGGPDDGDRILDEPLTEALSRRYLAYALSTIGSRALPDVRDGLKPVHRRVLY
AMSNMRLNPDAAARKCAKVVGEVMGNFHPHGDASIYDALVRLAQEFSQRIPLVEGQGNFG
NIDGDSAAAMRYTECKMTEAAMLLLDGIDEDAVDFRPTYDGQDEEPVVLPSGFPNLLANG
SSGIAVGMATSIPPHNAAELIDACQLLLANPDATTADLLEKVPGPDFPTGGVIVESRASL
LETYETGRGGVRMRAKWEKEDTGRGTYQIVVTEIPYQVKKSDLVEQLADLIDSKKAALLG
DVRDESAEDIRLVLEPKSKNVEPEVLMESLFKLSALESRFPVNINVLDARGTPGVMGIKQ
ALMAFLAHRREVLTRRARHRLAKIEARLHILDGLLIAYLNLDEVIRIVRYEDKPKEKLIE
TFGLTDIQADAILNTRLRQLAKLEEMEIRREHAELVEERDGILAMLASEAKQWKLVGVGL
SEVRAALLKIKHPLDKPRPTGVTGRSVFGEAPQVDADAAIEAMIVREPITIILSERGWIR
AAKGKIDDPSELKFKEGDKLGFLVPAETTDKLLIFSSDGRFFTLGCDKLPSARGHGEPVR
MMIELDDKVKIIDVFPFKAGRKRILASKGGYGFLMPEEEALANRKAGKQVLNVGNEGAAF
CLEAVGDQLAVIGDNGKILIFPLEELPEMPRGKGVKLQAYREGGLRDGLSFNAETGAYWI
DTAGRRRDWAEWKEWVGRRAGAGKLVPKGFATNKRFRPK