Protein Info for CCNA_01627 in Caulobacter crescentus NA1000 Δfur

Annotation: Holo-(acyl-carrier protein) synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00516: holo-[acyl-carrier-protein] synthase" amino acids 1 to 129 (129 residues), 88.2 bits, see alignment E=5.4e-29 TIGR00556: phosphopantetheine--protein transferase domain" amino acids 2 to 129 (128 residues), 72.4 bits, see alignment E=3.7e-24 PF01648: ACPS" amino acids 4 to 96 (93 residues), 57.9 bits, see alignment E=5e-20

Best Hits

Swiss-Prot: 100% identical to ACPS_CAUVN: Holo-[acyl-carrier-protein] synthase (acpS) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K00997, holo-[acyl-carrier protein] synthase [EC: 2.7.8.7] (inferred from 100% identity to ccr:CC_1558)

Predicted SEED Role

"Holo-[acyl-carrier protein] synthase (EC 2.7.8.7)" in subsystem Fatty Acid Biosynthesis FASII (EC 2.7.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B8H624 at UniProt or InterPro

Protein Sequence (133 amino acids)

>CCNA_01627 Holo-(acyl-carrier protein) synthase (Caulobacter crescentus NA1000 Δfur)
MIIGIGSDLCDIRRIEKSLERFGDRFTHKVFTETERTRSERKPDRASSYAKRFAAKEACS
KALGTGLKRGVHLAGMGVVNLPSGQPTMALTGGALERLKAMVPEGMEPVIHLSLTDDHPY
AQAFVIIEALPKR