Protein Info for CCNA_01576 in Caulobacter crescentus NA1000 Δfur

Annotation: major facilitator superfamily transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 387 (357 residues), 202.5 bits, see alignment E=4.7e-64

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to ccs:CCNA_01576)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C8B3 at UniProt or InterPro

Protein Sequence (431 amino acids)

>CCNA_01576 major facilitator superfamily transporter (Caulobacter crescentus NA1000 Δfur)
MGKEAKSMDVPKAPEPSEKIGRYRWIIVTLLFLAMVINYVDRQTIGFLKHDLSVEFGWSE
HDYANLVFYFQLSYAVAYLVWGKVMDKIGARWGFGIAFLIWQVAHIAHAGARGLTGFIFA
RMALGVGEAGGFPGGIKAVTEWFPKKERAFATGIFNAGTNIGAIVTPLVVPAIVLAWGWQ
MAFIVTGVAGLIWLPIWLLVYRTPRETKNLSAAELAHIEQDPADPVEKIAWTKLLTKRET
WAYAIGKFLIDPIWWMFLFWLPDFLGKRYGLDLKTFGPPIVAIYLLSDAGSVGGGWLSSN
FMKMGWSINRARKITMLICALLAVPVMFASFADSLWVAVLIIGVATAAHQGFSANLYTLP
SDVFPRGAVGSVVGIGGMLGAVGGMVFSKYIGGVLESIGTYTPIFIVAGSAYLLALLVVH
LLTPKMEPVKI