Protein Info for CCNA_01523 in Caulobacter crescentus NA1000 Δfur

Annotation: acetyltransferase flmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF13302: Acetyltransf_3" amino acids 4 to 139 (136 residues), 62.4 bits, see alignment E=1.5e-20 TIGR03585: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase" amino acids 5 to 160 (156 residues), 210.6 bits, see alignment E=6.4e-67 PF13420: Acetyltransf_4" amino acids 7 to 156 (150 residues), 31.9 bits, see alignment E=2.6e-11 PF13523: Acetyltransf_8" amino acids 11 to 143 (133 residues), 37.2 bits, see alignment E=4.4e-13 PF00583: Acetyltransf_1" amino acids 38 to 138 (101 residues), 49.1 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to ccr:CC_1456)

Predicted SEED Role

"flagellin modification protein FlmH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H3C854 at UniProt or InterPro

Protein Sequence (193 amino acids)

>CCNA_01523 acetyltransferase flmH (Caulobacter crescentus NA1000 Δfur)
MVAVRLRNLVESDRERLLIWRNSPDVSAYMYSDHKIGHEEHDHWFDVARHDPRRRYWIIE
ADGEPVGLANLADIDLVHRRCAWAYYLASPKVRGLGVGSFVEFQIIEYVFNQLHLNKLWC
EVLISNESVWRLHELYGFQREALFRQHVMKQGHEVDVIGLGLLASDWAARRDAMAERLCA
KGYTIPDLTCRAA